Cyp2s1 (NM_028775) Mouse Recombinant Protein

CAT#: TP508034

Purified recombinant protein of Mouse cytochrome P450, family 2, subfamily s, polypeptide 1 (Cyp2s1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208034 protein sequence
Red=Cloning site Green=Tags(s)

MEAASTWALLLALLLLLLLLSLTLFRTPARGYLPPGPTPLPLLGNLLQLRPGALYSGLLRLSKKYGPVFT
VYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGTLATLDKTFDGHGVFFANGERWKQLRKFTLLALRDLG
MGKREGEELIQAEVQSLVEAFQKTEGRPFNPSMLLAQATSNVVCSLVFGIRLPYDDKEFQAVIQAASGTL
LGISSPWGQAYEMFSWLLQPLPGPHTQLQHHLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQE
KQDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLRYPQVQQRVREELIQELGPGRAPSLSDRVR
LPYTDAVLHEAQRLLALVPMGMPHTITRTTCFRGYTLPKGTEVFPLIGSILHDPAVFQNPGEFHPGRFLD
EDGRLRKHEAFLPYSLGKRVCLGEGLARAELWLFFTSILQAFSLETPCPPGDLSLKPAISGLFNIPPDFQ
LRVWPTGDQSR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 55.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083051
Locus ID 74134
UniProt ID Q9DBX6
Refseq Size 2621
Cytogenetics 7 A3
Refseq ORF 1506
Synonyms 1200011C15Rik; AU041727; C79779
Summary A cytochrome P450 monooxygenase involved in the metabolism of retinoids and eicosanoids. In epidermis, may contribute to the oxidative metabolism of all-trans-retinoic acid. For this activity, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Additionally, displays peroxidase and isomerase activities toward various oxygenated eicosanoids such as prostaglandin H2 (PGH2) and hydroperoxyeicosatetraenoates (HPETEs). Independently of cytochrome P450 reductase, NADPH, and O2, catalyzes the breakdown of PGH2 to hydroxyheptadecatrienoic acid (HHT) and malondialdehyde (MDA), which is known to act as a mediator of DNA damage.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...