Foxs1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Fkhl18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	forkhead box S1
Database Link	NP_034356 Entrez Gene 14239 Mouse UniProt ID Q61574
Background	Fkhl18 is a transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters.Fkhl18 may have a role in the organization of the testicular vasculature.
Synonyms	FKHL18; FREAC-10; FREAC10; MGC4544
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 92%; Horse: 85%; Mouse: 85%; Bovine: 85%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.