Elongin A (TCEB3) Rabbit Polyclonal Antibody
CAT#: TA330044
Rabbit Polyclonal Anti-TCEB3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TCEB3 antibody: synthetic peptide directed towards the C terminal of human TCEB3. Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 87 kDa |
Gene Name | transcription elongation factor B subunit 3 |
Database Link | |
Background | Elongin A (TCEB3), which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits.This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. |
Synonyms | EloA; SIII; SIII p110; TCEB3A |
Note | Immunogen sequence homology: Dog: 100%; Chicken: 92%; Rat: 92%; Guinea pig: 91% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Elongin A产品