c-Jun (JUN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC, ChIP
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	Jun proto-oncogene, AP-1 transcription factor subunit
Database Link	NP_002219 Entrez Gene 3725 Human UniProt ID P05412
Background	JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	AP-1; AP1; c-Jun
Note	Immunogen sequence homology: Human: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways	B cell receptor signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Renal cell carcinoma, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.