C10orf131 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C10orf131 antibody is: synthetic peptide directed towards the middle region of Human C10orf131. Synthetic peptide located within the following region: EEEEFMKEFILTDILKVKAADYEDDQEQIKKQKANIFVPSSSPVVNQRKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	chromosome 10 open reading frame 131
Database Link	NP_001123918 Entrez Gene 387707 HumanEntrez Gene 100127889 Human
Background	The function of this protein remains unknown.
Synonyms	bA690P14.3
Note	Human: 100%; Pig: 92%; Dog: 85%; Rat: 85%; Bovine: 85%; Rabbit: 85%; Yeast: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.