C1QL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C1QL2 Antibody is: synthetic peptide directed towards the middle region of Human C1QL2. Synthetic peptide located within the following region: GTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	complement component 1, q subcomponent-like 2
Database Link	NP_872334 Entrez Gene 165257 Human UniProt ID Q7Z5L3
Background	C1QL2 may regulate the number of excitatory synapses that are formed on hippocampus neurons. It has no effect on inhibitory synapses.
Synonyms	C1QTNF10; CTRP10
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Dog: 86%; Pig: 85%; Mouse: 85%; Bovine: 85%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.