PA1 (PAGR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C16orf53 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf53. Synthetic peptide located within the following region: GPSASAGKAEDEGEGGREETEREGSGGEEAQGEVPSAGGEEPAEEDSEDW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	PAXIP1 associated glutamate rich protein 1
Database Link	NP_078792 Entrez Gene 79447 Human UniProt ID Q9BTK6
Background	The function of this protein remains unknown.
Synonyms	C16orf53; GAS; PA1
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%; Goat: 85%; Bovine: 85%; Pig: 83%; Horse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.