Retinoblastoma binding protein 1 (ARID4A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARID4A Antibody: synthetic peptide directed towards the C terminal of human ARID4A. Synthetic peptide located within the following region: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	143 kDa
Gene Name	AT-rich interaction domain 4A
Database Link	NP_002883 Entrez Gene 5926 Human UniProt ID P29374
Background	ARID4A encodes a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described.
Synonyms	RBBP-1; RBBP1; RBP-1; RBP1
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.