CCN3 (NOV) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NOV Antibody: synthetic peptide directed towards the C terminal of human NOV. Synthetic peptide located within the following region: KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	nephroblastoma overexpressed
Database Link	NP_002505 Entrez Gene 4856 Human UniProt ID P48745
Background	As an immediate-early protein, NOV is likely to play a role in cell growth regulation.
Synonyms	CCN3; IBP-9; IGFBP-9; IGFBP9; NOVh
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 85%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.