TRAF4AF1 (KNSTRN) Rabbit Polyclonal Antibody

CAT#: TA333584

Rabbit Polyclonal Anti-KNSTRN Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human chromosome 15 open reading frame 23 (C15orf23), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of chromosome 15 open reading frame 23 (C15orf23), transcript variant 3
    • 100 ug

CNY 3,080.00


Recombinant protein of human chromosome 15 open reading frame 23 (C15orf23), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of chromosome 15 open reading frame 23 (C15orf23), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-C15orf23 Antibody is: synthetic peptide directed towards the middle region of Human C15orf23. Synthetic peptide located within the following region: TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name kinetochore-localized astrin/SPAG5 binding protein
Background C15orf23 is an essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. It promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments.
Synonyms C15orf23; HSD11; SKAP; TRAF4AF1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 85%; Yeast: 82%; Rat: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...