T Rabbit Polyclonal Antibody

CAT#: TA334030

Rabbit Polyclonal Anti-T Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of T, brachyury homolog (mouse) (T)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human T, brachyury homolog (mouse) (T), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human T, brachyury homolog (mouse) (T), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-T Antibody: synthetic peptide directed towards the N terminal of human T. Synthetic peptide located within the following region: SSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 47 kDa
Gene Name T brachyury transcription factor
Background The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.
Synonyms SAVA; TFT
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Dog: 92%; Rabbit: 92%
Reference Data
Protein Families ES Cell Differentiation/IPS, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...