MANSC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MANSC1 Antibody: synthetic peptide directed towards the N terminal of human MANSC1. Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	MANSC domain containing 1
Database Link	NP_060520 Entrez Gene 54682 Human UniProt ID Q9H8J5
Background	MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined.
Synonyms	9130403P13Rik; LOH12CR3
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 90%; Rat: 90%; Mouse: 90%; Bovine: 83%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.