HEXIM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HEXIM1 Antibody: synthetic peptide directed towards the C terminal of human HEXIM1. Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	hexamethylene bis-acetamide inducible 1
Database Link	NP_006451 Entrez Gene 10614 Human UniProt ID O94992
Background	HEXIM1 expression is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. The function of this protein is not yet known.
Synonyms	CLP1; EDG1; HIS1; MAQ1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Yeast: 82%; Zebrafish: 80%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.