PTPLAD2 (HACD4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PTPLAD2 Antibody: synthetic peptide directed towards the middle region of human PTPLAD2. Synthetic peptide located within the following region: LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	3-hydroxyacyl-CoA dehydratase 4
Database Link	NP_001010915 Entrez Gene 401494 Human UniProt ID Q5VWC8
Background	PTPLAD2 is a multi-pass membrane protein. It belongs to the PTPLA family. The function of the PTPLAD2 protein remains unknown.
Synonyms	PTPLAD2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.