CYP27C1 Rabbit Polyclonal Antibody

CAT#: TA336202

Rabbit Polyclonal Anti-CYP27C1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of cytochrome P450, family 27, subfamily C, polypeptide 1 (CYP27C1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human cytochrome P450, family 27, subfamily C, polypeptide 1 (CYP27C1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human cytochrome P450, family 27, subfamily C, polypeptide 1 (CYP27C1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-CYP27C1 Antibody: synthetic peptide directed towards the middle region of human CYP27C1. Synthetic peptide located within the following region: VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name cytochrome P450 family 27 subfamily C member 1
Background The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.
Synonyms FLJ16008
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, P450
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...