FBXO39 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FBXO39 antibody: synthetic peptide directed towards the middle region of human FBXO39. Synthetic peptide located within the following region: RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	F-box protein 39
Database Link	NP_694962 Entrez Gene 162517 Human UniProt ID Q8N4B4
Background	FBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). [supplied by OMIM]
Synonyms	CT144; Fbx39
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.