KIR5.1 (KCNJ16) Rabbit Polyclonal Antibody
CAT#: TA338587
Rabbit Polyclonal Anti-Kcnj16 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Kcnj16 antibody is: synthetic peptide directed towards the C-terminal region of Rat Kcnj16. Synthetic peptide located within the following region: VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | potassium voltage-gated channel subfamily J member 16 |
Database Link | |
Background | inward rectifying potassium channel; may be involved in renal pH regulation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: BC078776.1 [ECO:0000332] ##Evidence-Data-END## |
Synonyms | BIR9; KIR5.1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |