Dnajc22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dnajc22 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	DnaJ heat shock protein family (Hsp40) member C22
Database Link	NP_789805 Entrez Gene 72778 Mouse UniProt ID Q8CHS2
Background	The function remains unknown.
Synonyms	FLJ13236; wus
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.