CDT2 (DTL) Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DTL antibody: synthetic peptide directed towards the N terminal of human DTL. Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 79 kDa |
Gene Name | denticleless E3 ubiquitin protein ligase homolog |
Database Link | |
Background | DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells. |
Synonyms | CDT2; DCAF2; L2DTL; RAMP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |