CDT2 (DTL) Rabbit Polyclonal Antibody

CAT#: TA339337

Rabbit Polyclonal Anti-DTL Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of denticleless homolog (Drosophila) (DTL)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Purified recombinant protein of Homo sapiens denticleless homolog (Drosophila) (DTL), 20 µg
    • 20 ug

CNY 2,900.00


Purified recombinant protein of Homo sapiens denticleless homolog (Drosophila) (DTL), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DTL antibody: synthetic peptide directed towards the N terminal of human DTL. Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 79 kDa
Gene Name denticleless E3 ubiquitin protein ligase homolog
Background DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.
Synonyms CDT2; DCAF2; L2DTL; RAMP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...