ZNF312B (FEZF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FEZF1 antibody: synthetic peptide directed towards the C terminal of human FEZF1. Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	FEZ family zinc finger 1
Database Link	NP_001019784 Entrez Gene 389549 Human UniProt ID A0PJY2
Background	FEZF1 is a transcription repressor. It is involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). It plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression of the FEZF1 is required in OSN to cell-autonomously regulate OSN axon projections. FEZF1 regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. It may be required for correct rostral migration of the interneuron progenitors.
Synonyms	FEZ; HH22; ZNF312B
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 92%; Pig: 79%; Horse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.