DPH2 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DPH2 antibody: synthetic peptide directed towards the N terminal of human DPH2. Synthetic peptide located within the following region: TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | DPH2 homolog |
Database Link | |
Background | DPH2 gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene. |
Synonyms | DPH2L2 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |