TDRD9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TDRD9 antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD9. Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	152 kDa
Gene Name	tudor domain containing 9
Database Link	NP_694591 Entrez Gene 122402 Human UniProt ID Q8NDG6
Background	Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and preventingTheir mobilization, which is essential forThe germline integrity. Acts viaThe piRNA metabolic process, which mediatesThe repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governThe methylation and subsequent repression of transposons. Its association with PIWIL4 andThe piP-bodies suggests a participation inThe secondary piRNAs metabolic process.
Synonyms	C14orf75; HIG-1; NET54
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Yeast: 89%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.