ANXA8L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the N terminal of human ANXA8L2. Synthetic peptide located within the following region: PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	annexin A8-like 1
Database Link	NP_001621 Entrez Gene 244 Entrez Gene 728113 Human UniProt ID Q5VT79
Background	ANXA8L2 is a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. ANXA8L2 may function as an an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression of ANXA8L2 has been associated with acute myelocytic leukemia.This gene encodes a member ofThe annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins.The encoded protein may function as an an anticoagulant that indirectly inhibitsThe thromboplastin-specific complex. Overexpression ofThis gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy ofThis gene is found in close proximity onThe long arm of chromosome 10.
Synonyms	ANXA8; bA145E20.2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.