Annexin IV (ANXA4) Rabbit Polyclonal Antibody

CAT#: TA341702

Rabbit Polyclonal Anti-ANXA4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of annexin A4 (ANXA4)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human annexin A4 (ANXA4), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human annexin A4 (ANXA4), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human, Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the N terminal of human ANXA4. Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name annexin A4
Background Annexin IV (ANX4) belongs toThe annexin family of calcium-dependent phospholipid binding proteins. AlthoughTheir functions are still not clearly defined, several members ofThe annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq, Jul 2008]
Synonyms ANX4; HEL-S-274; PIG28; ZAP36
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...