ST3GAL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Database Link	NP_008858 Entrez Gene 6483 Human UniProt ID Q16842
Background	The protein encoded byThis gene is a type II membrane protein that catalyzesThe transfer of sialic acid from CMP-sialic acid to galactose-containing substrates.The encoded protein is normally found inThe Golgi but can be proteolytically processed to a soluble form.This protein, which is a member of glycosyltransferase family 29, can useThe same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq, Jul 2008]
Synonyms	Gal-NAc6S; SIAT4B; ST3GalA.2; ST3GALII
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Keratan sulfate biosynthesis, Metabolic pathways, O-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.