Siglec 7 (SIGLEC7) Rabbit Polyclonal Antibody

CAT#: TA341934

Rabbit Polyclonal Anti-SIGLEC7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of sialic acid binding Ig-like lectin 7 (SIGLEC7), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SIGLEC7 antibody: synthetic peptide directed towards the middle region of human SIGLEC7. Synthetic peptide located within the following region: WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 51 kDa
Gene Name sialic acid binding Ig like lectin 7
Background SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. InThe immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) viaTheir SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC7 mediates inhibition of natural killer cells cytotoxicity. It may also play a role in hemopoiesis. SIGLEC7 inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).
Synonyms AIRM1; CD328; CDw328; D-siglec; p75; QA79; SIGLEC-7; SIGLEC19P; SIGLECP2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...