KCNK4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	potassium two pore domain channel subfamily K member 4
Database Link	NP_201567 Entrez Gene 50801 Human UniProt ID Q9NYG8
Background	Potassium channels play a role in many cellular processes including maintenance ofThe action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.Potassium channels play a role in many cellular processes including maintenance ofThe action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow.This gene encodes one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains.The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
Synonyms	K2p4.1; TRAAK; TRAAK1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Rabbit: 93%; Dog: 86%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.