Protein kinase Y linked (PRKY) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRKY antibody: synthetic peptide directed towards the N terminal of human PRKY. Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	protein kinase, Y-linked, pseudogene
Database Link	NP_002751 Entrez Gene 5616 Human UniProt ID O43930
Background	This gene is similar toThe protein kinase, X-linked gene inThe pseudoautosomal region ofThe X chromosome.The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination betweenThis gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010]
Synonyms	OTTHUMP00000033227; protein kinase; Y-linked
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.