OSGIN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OSGIN2 antibody: synthetic peptide directed towards the C terminal of human OSGIN2. Synthetic peptide located within the following region: ECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	oxidative stress induced growth inhibitor family member 2
Database Link	NP_004328 Entrez Gene 734 Human UniProt ID Q9Y236
Background	OSGIN2 may be involved in meiosis or the maturation of germ cells.
Synonyms	C8orf1; hT41
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 87%; Bovine: 87%; Guinea pig: 80%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.