MAP6 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAP6 antibody is: synthetic peptide directed towards the middle region of Human MAP6. Synthetic peptide located within the following region: IRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 86 kDa |
Gene Name | microtubule associated protein 6 |
Database Link | |
Background | This gene encodes a microtubule-associated protein. The encoded protein is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. |
Synonyms | MAP6-N; MTAP6; N-STOP; STOP |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |