Acyl CoA Thioesterase 9 (ACOT9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACOT9 antibody: synthetic peptide directed towards the N terminal of human ACOT9. Synthetic peptide located within the following region: TQGPQNPKKQGIFHIHEACSSIHVNHVRDKLREIVGASTNWRDHVKAMEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	acyl-CoA thioesterase 9
Database Link	NP_001032248 Entrez Gene 23597 Human UniProt ID Q9Y305
Background	The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms	ACATE2; CGI-16; MT-ACT48; MTACT48
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.