PSD3 Rabbit Polyclonal Antibody

CAT#: TA344112

Rabbit Polyclonal Anti-PSD3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1
    • 100 ug

CNY 4,840.00


Purified recombinant protein of Homo sapiens pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PSD3 antibody: synthetic peptide directed towards the middle region of human PSD3. Synthetic peptide located within the following region: SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name pleckstrin and Sec7 domain containing 3
Background PSD3 is a guanine nucleotide exchange factor for ARF6.
Synonyms EFA6D; EFA6R; HCA67
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Pathways Endocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...