PEF1 Rabbit Polyclonal Antibody

CAT#: TA344308

Rabbit Polyclonal Anti-PEF1 Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of penta-EF-hand domain containing 1 (PEF1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human penta-EF-hand domain containing 1 (PEF1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human penta-EF-hand domain containing 1 (PEF1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PEF1 antibody: synthetic peptide directed towards the middle region of human PEF1. Synthetic peptide located within the following region: WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 31 kDa
Gene Name penta-EF-hand domain containing 1
Background PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2 (PDCD6; MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]). [supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1640 AB026628.1 1-1640
Synonyms ABP32; PEF1A
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 91%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...