HSD3B1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Monkey
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Database Link	NP_000853 Entrez Gene 3283 Human UniProt ID P14060
Background	3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Synonyms	3BETAHSD; HSD3B; HSDB3; HSDB3A; I; SDR11E1
Note	Immunogen Sequence Homology: Human: 100%; Goat: 82%; Pig: 79%; Rat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.