Ogn Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	osteoglycin
Database Link	NP_001099573 Entrez Gene 291015 Rat
Background	The function of this protein remains unknown.
Synonyms	DKFZp586P2421; mimecan; OG; OIF; osteoglycin; SLRR3A
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Goat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.