COX17 (NM_005694) Human Tagged ORF Clone
CAT#: RC210756
- TrueORF®
COX17 (Myc-DDK-tagged)-Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_005694" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210756 representing NM_005694
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGGGTCTGGTTGACTCAAACCCTGCCCCGCCTGAGTCTCAGGAGAAGAAGCCGCTGAAGCCCTGCT GCGCTTGCCCGGAGACCAAGAAGGCGCGCGATGCGTGTATCATCGAGAAAGGAGAAGAACACTGTGGACA TCTAATTGAGGCCCACAAGGAATGCATGAGAGCCCTAGGATTTAAAATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210756 representing NM_005694
Red=Cloning site Green=Tags(s) MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005694 |
ORF Size | 189 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005694.2 |
RefSeq Size | 423 bp |
RefSeq ORF | 192 bp |
Locus ID | 10063 |
UniProt ID | Q14061 |
Protein Pathways | Metabolic pathways, Oxidative phosphorylation |
MW | 6.7 kDa |
Gene Summary | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210756L1 | Lenti-ORF clone of COX17 (Myc-DDK-tagged)-Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein |
CNY 5,890.00 |
|
RC210756L2 | Lenti-ORF clone of COX17 (mGFP-tagged)-Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein |
CNY 3,600.00 |
|
RC210756L3 | Lenti-ORF clone of COX17 (Myc-DDK-tagged)-Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein |
CNY 5,890.00 |
|
RC210756L4 | Lenti-ORF clone of COX17 (mGFP-tagged)-Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein |
CNY 5,890.00 |
|
RG210756 | COX17 (tGFP-tagged) - Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein |
CNY 4,370.00 |
|
SC116566 | COX17 (untagged)-Human COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX17), nuclear gene encoding mitochondrial protein |
CNY 1,200.00 |