Sumo 3 (SUMO3) (NM_006936) Human Mass Spec Standard
CAT#: PH300241
SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867)
View other "Sumo 3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200241 |
Predicted MW | 11.6 kDa |
Protein Sequence |
>RC200241 protein sequence
Red=Cloning site Green=Tags(s) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008867 |
RefSeq Size | 1831 |
RefSeq ORF | 309 |
Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3 |
Locus ID | 6612 |
Cytogenetics | 21q22.3 |
Summary | This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402068 | SUMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402068 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3,080.00 |
|
TP300241 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), 20 µg |
CNY 2,900.00 |
|
TP720508 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3,140.00 |
|
TP721152 | Purified recombinant protein of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3,140.00 |