TRIAP1 (NM_016399) Human Mass Spec Standard
CAT#: PH301032
TRIAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057483)
View other "TRIAP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TRIAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057483) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201032 |
Predicted MW | 8.8 kDa |
Protein Sequence |
>RC201032 protein sequence
Red=Cloning site Green=Tags(s) MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE KPENSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057483 |
RefSeq Size | 1196 |
RefSeq ORF | 228 |
Synonyms | HSPC132; MDM35; P53CSV; WF-1 |
Locus ID | 51499 |
Cytogenetics | 12q24.31 |
Summary | Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane (PubMed:23931759). Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) (PubMed:26071602). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (PubMed:15735003).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413997 | TRIAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413997 | Transient overexpression lysate of TP53 regulated inhibitor of apoptosis 1 (TRIAP1) |
CNY 3,080.00 |
|
TP301032 | Recombinant protein of human TP53 regulated inhibitor of apoptosis 1 (TRIAP1), 20 µg |
CNY 2,900.00 |