RAB25 (NM_020387) Human Mass Spec Standard
CAT#: PH303413
RAB25 MS Standard C13 and N15-labeled recombinant protein (NP_065120)
View other "RAB25" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB25 MS Standard C13 and N15-labeled recombinant protein (NP_065120) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203413 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC203413 protein sequence
Red=Cloning site Green=Tags(s) MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEA RMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC ISL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065120 |
RefSeq Size | 1101 |
RefSeq ORF | 639 |
Synonyms | CATX-8; RAB11C |
Locus ID | 57111 |
Cytogenetics | 1q22 |
Summary | The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. Two variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402782 | RAB25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402782 | Transient overexpression lysate of RAB25, member RAS oncogene family (RAB25) |
CNY 3,080.00 |
|
TP303413 | Recombinant protein of human RAB25, member RAS oncogene family (RAB25), 20 µg |
CNY 2,900.00 |