Reticulocalbin 3 (RCN3) (NM_020650) Human Mass Spec Standard
CAT#: PH303708
RCN3 MS Standard C13 and N15-labeled recombinant protein (NP_065701)
View other "Reticulocalbin 3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RCN3 MS Standard C13 and N15-labeled recombinant protein (NP_065701) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203708 |
Predicted MW | 37.5 kDa |
Protein Sequence |
>RC203708 protein sequence
Red=Cloning site Green=Tags(s) MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQ LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRN ATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLE DLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLV EANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065701 |
RefSeq Size | 1882 |
RefSeq ORF | 984 |
Synonyms | RLP49 |
Locus ID | 57333 |
Cytogenetics | 19q13.33 |
Summary | Probable molecular chaperone assisting protein biosynthesis and transport in the endoplasmic reticulum (PubMed:16433634, PubMed:28939891). Required for the proper biosynthesis and transport of pulmonary surfactant-associated protein A/SP-A, pulmonary surfactant-associated protein D/SP-D and the lipid transporter ABCA3 (By similarity). By regulating both the proper expression and the degradation through the endoplasmic reticulum-associated protein degradation pathway of these proteins plays a crucial role in pulmonary surfactant homeostasis (By similarity). Has an anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens (PubMed:28939891). This calcium-binding protein also transiently associates with immature PCSK6 and regulates its secretion (PubMed:16433634).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402802 | RCN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402802 | Transient overexpression lysate of reticulocalbin 3, EF-hand calcium binding domain (RCN3) |
CNY 3,080.00 |
|
TP303708 | Recombinant protein of human reticulocalbin 3, EF-hand calcium binding domain (RCN3), 20 µg |
CNY 2,900.00 |
其它Reticulocalbin 3产品