Dysbindin (DTNBP1) (NM_032122) Human Mass Spec Standard
CAT#: PH304208
DTNBP1 MS Standard C13 and N15-labeled recombinant protein (NP_115498)
View other "Dysbindin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DTNBP1 MS Standard C13 and N15-labeled recombinant protein (NP_115498) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204208 |
Predicted MW | 39.5 kDa |
Protein Sequence |
>RC204208 protein sequence
Red=Cloning site Green=Tags(s) MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA SAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG QCELERCKHMQSQQLENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY LSTGYLQIAERREPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGPESSTCQNE ITLQVPNPSELRAKPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSD S myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115498 |
RefSeq Size | 1429 |
RefSeq ORF | 1053 |
Synonyms | BLOC1S8; DBND; HPS7; My031; SDY |
Locus ID | 84062 |
Cytogenetics | 6p22.3 |
Summary | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403167 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405212 | DTNBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403167 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 1 |
CNY 3,080.00 |
|
LY405212 | Transient overexpression lysate of dystrobrevin binding protein 1 (DTNBP1), transcript variant 2 |
CNY 3,080.00 |
|
TP304208 | Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP323289 | Recombinant protein of human dystrobrevin binding protein 1 (DTNBP1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP761501 | Purified recombinant protein of Human dystrobrevin binding protein 1 (DTNBP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Dysbindin产品