Bcl G (BCL2L14) (NM_138722) Human Mass Spec Standard
CAT#: PH306404
BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620048)
View other "Bcl G" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620048) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206404 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC206404 protein sequence
Red=Cloning site Green=Tags(s) MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEV SWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQC LEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILA KIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTA KLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620048 |
RefSeq Size | 1886 |
RefSeq ORF | 981 |
Synonyms | BCLG |
Locus ID | 79370 |
Cytogenetics | 12p13.2 |
Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408531 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408532 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408533 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410728 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429763 | BCL2L14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408531 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1 |
CNY 3,080.00 |
|
LY408532 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4 |
CNY 3,080.00 |
|
LY408533 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 3 |
CNY 3,080.00 |
|
LY410728 | Transient overexpression lysate of BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 2 |
CNY 3,080.00 |
|
PH315213 | BCL2L14 MS Standard C13 and N15-labeled recombinant protein (NP_620049) |
CNY 19,520.00 |
|
TP306404 | Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315213 | Recombinant protein of human BCL2-like 14 (apoptosis facilitator) (BCL2L14), transcript variant 4, 20 µg |
CNY 2,900.00 |