ITM2C (NM_001012514) Human Mass Spec Standard
CAT#: PH308687
ITM2C MS Standard C13 and N15-labeled recombinant protein (NP_001012532)
View other "ITM2C" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ITM2C MS Standard C13 and N15-labeled recombinant protein (NP_001012532) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208687 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC208687 protein sequence
Red=Cloning site Green=Tags(s) MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPARLARDNFFRCGVLYEDSLSSQVRTQMELEED VKIYLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVK RGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRINKRGAKNCNAIRHFENTF VVETLICGVV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012532 |
RefSeq Size | 1974 |
RefSeq ORF | 660 |
Synonyms | BRI3; BRICD2C; E25; E25C; ITM3 |
Locus ID | 81618 |
Cytogenetics | 2q37.1 |
Summary | Negative regulator of amyloid-beta peptide production. May inhibit the processing of APP by blocking its access to alpha- and beta-secretase. Binding to the beta-secretase-cleaved APP C-terminal fragment is negligible, suggesting that ITM2C is a poor gamma-secretase cleavage inhibitor. May play a role in TNF-induced cell death and neuronal differentiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403097 | ITM2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422880 | ITM2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422882 | ITM2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403097 | Transient overexpression lysate of integral membrane protein 2C (ITM2C), transcript variant 1 |
CNY 3,080.00 |
|
LY422880 | Transient overexpression lysate of integral membrane protein 2C (ITM2C), transcript variant 3 |
CNY 3,080.00 |
|
LY422882 | Transient overexpression lysate of integral membrane protein 2C (ITM2C), transcript variant 2 |
CNY 3,080.00 |
|
TP308687 | Recombinant protein of human integral membrane protein 2C (ITM2C), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP761803 | Purified recombinant protein of Human integral membrane protein 2C (ITM2C), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |