HMG14 (HMGN1) (NM_004965) Human Mass Spec Standard
CAT#: PH310454
HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956)
View other "HMG14" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210454 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC210454 protein sequence
Red=Cloning site Green=Tags(s) MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEANPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET KEDLPAENGETKTEESPASDEAGEKEAKSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004956 |
RefSeq Size | 1313 |
RefSeq ORF | 300 |
Synonyms | HMG14 |
Locus ID | 3150 |
Cytogenetics | 21q22.2 |
Summary | The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. [provided by RefSeq, Aug 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417625 | HMGN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417625 | Transient overexpression lysate of high-mobility group nucleosome binding domain 1 (HMGN1) |
CNY 3,080.00 |
|
TP310454 | Recombinant protein of human high-mobility group nucleosome binding domain 1 (HMGN1), 20 µg |
CNY 2,900.00 |