Precerebellin (CBLN1) (NM_004352) Human Mass Spec Standard
CAT#: PH310797
CBLN1 MS Standard C13 and N15-labeled recombinant protein (NP_004343)
View other "Precerebellin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CBLN1 MS Standard C13 and N15-labeled recombinant protein (NP_004343) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210797 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC210797 protein sequence
Red=Cloning site Green=Tags(s) MLGVLELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRST NHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVIS AFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004343 |
RefSeq Size | 2435 |
RefSeq ORF | 579 |
Locus ID | 869 |
Cytogenetics | 16q12.1 |
Summary | This gene encodes a cerebellum-specific precursor protein, precerebellin, with similarity to the globular (non-collagen-like) domain of complement component C1qB. Precerebellin is processed to give rise to several derivatives, including the hexadecapeptide, cerebellin, which is highly enriched in postsynaptic structures of Purkinje cells. Cerebellin has also been found in human and rat adrenals, where it has been shown to enhance the secretory activity of this gland. [provided by RefSeq, Aug 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418047 | CBLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418047 | Transient overexpression lysate of cerebellin 1 precursor (CBLN1) |
CNY 3,080.00 |
|
TP310797 | Recombinant protein of human cerebellin 1 precursor (CBLN1), 20 µg |
CNY 2,900.00 |
其它Precerebellin产品