IL36 beta (IL36B) (NM_173178) Human Mass Spec Standard
CAT#: PH311037
IL1F8 MS Standard C13 and N15-labeled recombinant protein (NP_775270)
View other "IL36 beta" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IL1F8 MS Standard C13 and N15-labeled recombinant protein (NP_775270) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211037 |
Predicted MW | 17.7 kDa |
Protein Sequence |
>RC211037 protein sequence
Red=Cloning site Green=Tags(s) MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKD LCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLT KERGITNNTNFYLDSVE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_775270 |
RefSeq Size | 1068 |
RefSeq ORF | 471 |
Synonyms | FIL1; FIL1-(ETA); FIL1H; FILI-(ETA); IL-1F8; IL-1H2; IL1-ETA; IL1F8; IL1H2 |
Locus ID | 27177 |
Cytogenetics | 2q14.1 |
Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406635 | IL36B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406635 | Transient overexpression lysate of interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2 |
CNY 3,080.00 |
|
TP311037 | Recombinant protein of human interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它IL36 beta产品