PVRL1 (NECTIN1) (NM_002855) Human Mass Spec Standard
CAT#: PH311214
PVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_002846)
View other "PVRL1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | PVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_002846) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211214 |
Predicted MW | 57.2 kDa |
Protein Sequence |
>RC211214 protein sequence
Red=Cloning site Green=Tags(s) MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKS TNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNL TVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISR YRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEY HWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAG PVPTAIIGGVAGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQY DPEQLDLAENMVSQNDGSFISKKEWYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002846 |
RefSeq Size | 5493 |
RefSeq ORF | 1551 |
Synonyms | CD111; CLPED1; ED4; HIgR; HV1S; HVEC; nectin-1; OFC7; PRR; PRR1; PVRL1; PVRR; PVRR1; SK-12 |
Locus ID | 5818 |
Cytogenetics | 11q23.3 |
Summary | This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain (in some isoforms), and a cytoplasmic region. This protein acts as a receptor for glycoprotein D (gD) of herpes simplex viruses 1 and 2 (HSV-1, HSV-2), and pseudorabies virus (PRV) and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome (CLPED1) as well as non-syndromic cleft lip with or without cleft palate (CL/P). Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Adherens junction, Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404370 | PVRL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419083 | PVRL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404370 | Transient overexpression lysate of poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 3 |
CNY 3,080.00 |
|
LY419083 | Transient overexpression lysate of poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 1 |
CNY 3,080.00 |
|
TP311214 | Recombinant protein of human poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720410 | Purified recombinant protein of Homo sapiens poliovirus receptor-related 1 (herpesvirus entry mediator C) (PVRL1), transcript variant 1 |
CNY 3,140.00 |