PROP1 (NM_006261) Human Mass Spec Standard
CAT#: PH318746
PROP1 MS Standard C13 and N15-labeled recombinant protein (NP_006252)
View other "PROP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PROP1 MS Standard C13 and N15-labeled recombinant protein (NP_006252) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218746 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC218746 protein sequence
Red=Cloning site Green=Tags(s) MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHSRR RHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSP AAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPP PPPMLPLSLEPSKSWN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006252 |
RefSeq Size | 1464 |
RefSeq ORF | 678 |
Synonyms | CPHD2; PROP-1 |
Locus ID | 5626 |
Cytogenetics | 5q35.3 |
Summary | This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone expression. Mutations in this gene have been associated with combined pituitary hormone deficiency-2 as well as deficiencies in luteinizing hormone, follicle-stimulating hormone, growth hormone, prolactin, and thyroid-stimulating hormone. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416763 | PROP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416763 | Transient overexpression lysate of PROP paired-like homeobox 1 (PROP1) |
CNY 3,080.00 |
|
TP318746 | Recombinant protein of human PROP paired-like homeobox 1 (PROP1), 20 µg |
CNY 2,900.00 |