LANCL1 (NM_001136575) Human Mass Spec Standard
CAT#: PH326718
LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047)
View other "LANCL1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226718 |
Predicted MW | 45.3 kDa |
Protein Sequence |
>RC226718 protein sequence
Red=Cloning site Green=Tags(s) MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001130047 |
RefSeq Size | 4526 |
RefSeq ORF | 1197 |
Synonyms | GPR69A; p40 |
Locus ID | 10314 |
Cytogenetics | 2q34 |
Summary | This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401823 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427929 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427930 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401823 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1 |
CNY 3,080.00 |
|
LY427929 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2 |
CNY 3,080.00 |
|
LY427930 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3 |
CNY 3,080.00 |
|
PH305279 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_006046) |
CNY 19,520.00 |
|
PH327716 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) |
CNY 19,520.00 |
|
TP305279 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326718 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP327716 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2, 20 µg |
CNY 2,900.00 |