Dynein light chain (DNAL4) (NM_005740) Human Recombinant Protein
CAT#: TP300520L
Recombinant protein of human dynein, axonemal, light chain 4 (DNAL4), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200520 protein sequence
Red=Cloning site Green=Tags(s) MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005731 |
Locus ID | 10126 |
UniProt ID | O96015 |
Refseq Size | 1504 |
Cytogenetics | 22q13.1 |
Refseq ORF | 315 |
Synonyms | MRMV3; PIG27 |
Summary | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014] |
Protein Pathways | Huntington's disease |
Documents
FAQs |
SDS |
其它Dynein light chain产品